Everything below concerns container closure. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2026-05-14. Numbers and descriptions here follow the published literature rather than marketing material.
Quality control for freeze-dried forms includes visual inspection, water content measurement, and reconstitution time. A satisfactory cake is typically uniform, porous, and intact, although minor shrinkage or cracking may be acceptable if specifications allow. Karl Fischer titration, thermal gravimetric analysis, and near-infrared spectroscopy are used to measure water content. Reconstitution is assessed by adding a specified diluent and recording the time and ease of dissolution. Microbiological and particulate tests are added when the product is sterile or intended for injection.
Stability of a lyophilized solid depends on water content, temperature, and the physical state of the formulation. Amorphous products may slowly absorb moisture and drop below their glass transition temperature, causing collapse or crystallization. Some proteins and peptides can aggregate even in a dry state, especially when exposed to heat or moisture. Accelerated stability studies at elevated temperature and humidity help estimate shelf life, but real-time data remain the basis for expiration dating.
Analytical methods for lyophilized materials include X-ray diffraction for crystallinity, differential scanning calorimetry for thermal transitions, and scanning electron microscopy for pore morphology. Moisture sorption analysis shows how the cake responds to humidity. These methods help distinguish amorphous from crystalline states and detect phase changes. Open questions remain about how pore structure changes during long-term storage and how best to predict collapse under varied conditions. Comparisons across studies are complicated by differences in formulation, cycle, and storage history.
Quality control for lyophilized products focuses on appearance, moisture level, reconstitution time, and structural integrity. A cake should be uniform, intact, and free of meltback or collapse. Moisture level is measured by Karl Fischer titration or thermogravimetric analysis. Reconstitution time reflects pore structure and formulation. Visual inspection and vial integrity checks detect cracks, stopper defects, or particulate matter. These checks are often performed on samples from each batch. They help confirm that the drying cycle performed as intended.
| Property | Value | Notes |
|---|---|---|
| Appearance | Porous cake or plug | Uniform structure suggests the drying cycle preserved the matrix. |
| Reconstitution time | Usually under 2 minutes | Depends on cake porosity, diluent volume, and excipient composition. |
| Water content range | 0.5–3% w/w | Common specification range; exact limits are product-specific. |
| Headspace oxygen | <1% v/v | Inert gas backfill reduces oxidation of sensitive materials. |
| Storage temperature | 2–8 °C or controlled room temperature | Choice depends on accelerated and real-time stability results. |
Regulatory expectations for lyophilized products focus on consistent manufacture and documented stability. Batches are often monitored for moisture, appearance, potency, and sterility where applicable. Process parameters such as shelf temperature, chamber pressure, and drying time are recorded and controlled within validated ranges. Open questions remain about how best to predict long-term stability from short accelerated studies, especially for complex biologics. Variations in freezing rate and ice crystal size can produce differences that are not always visible but may affect performance.
After drying, a lyophilized product is usually sealed under vacuum or an inert gas to limit moisture uptake. Residual water content is measured because small changes can alter chemical stability and cake appearance. Storage temperature depends on the material; many biological products are kept at 2–8 °C, while some require −20 °C or colder. Exposure to ambient humidity during handling can cause the porous solid to absorb water and collapse. Container closures and stoppers are therefore selected for low moisture transmission and compatibility.
Handling practices aim to prevent moisture ingress and mechanical damage. Vials should remain stoppered and crimped until use, and reconstitution should follow the labeled diluent and volume. Shipping may involve temperature-controlled containers and desiccants, but direct contact between desiccant and product is avoided. Regulatory guidance expects documented storage conditions, excursion assessments, and stability commitments. Open questions remain about how best to predict long-term stability from short accelerated studies for every formulation class.
After lyophilization, the product is usually a porous cake or powder with a large internal surface area. This structure can absorb moisture quickly if exposed to humid air, so vials are sealed under vacuum or an inert gas. Moisture uptake may lower the glass transition temperature of the dried matrix and accelerate chemical or physical degradation. Storage conditions therefore depend on the formulation, container, and intended shelf life. Some products remain stable at room temperature, while others require refrigeration or freezing.
Quality control for lyophilized products includes appearance, cake structure, reconstitution time, pH, residual moisture, and potency. Residual moisture is a key attribute because excess water can reduce stability, while excessively low moisture may cause structural changes or aggregation in some systems. Stability studies compare real-time and accelerated conditions to estimate shelf life. Analytical methods must be validated for the specific matrix, container, and moisture range. Sterility and container integrity are also monitored for sterile products.
Misconceptions about lyophilization include the idea that dried products are indefinitely stable or that vacuum sealing eliminates all degradation. Chemical reactions can continue in the solid state, and some proteins lose activity even at low moisture. Another misconception is that any freeze-dryer cycle can be scaled by time alone; heat and mass transfer differ with equipment and load. Open questions remain about predicting long-term stability from short accelerated studies, particularly for amorphous formulations. Real-time stability data remain the standard for shelf-life assignment.
After lyophilization, the dried product is often sealed under vacuum or an inert gas to limit moisture and oxygen exposure. Vials, stoppers, and seals must maintain their barrier throughout shelf life. Storage temperature depends on product sensitivity: some cakes tolerate controlled room temperature, while labile biologics require refrigeration. Humidity is a critical variable because dried cakes are hygroscopic and can absorb water when exposed to air. Handling procedures therefore limit open-vial time and use desiccated environments for sampling.
Quality control for lyophilized materials examines appearance, reconstitution time, residual moisture, and mechanical integrity. An acceptable cake is usually uniform and porous, though appearance alone does not prove stability. Karl Fischer titration is a common method for water content, while differential scanning calorimetry can reveal glass transition events. Stability studies track potency, aggregation, and moisture over time under defined temperature and humidity conditions. Specifications are product-specific and may include sterility and endotoxin tests for sterile preparations.
C4H2N2O4 + GSH → C4H3N2O4• + GS• C4H3N2O4• + GSH → C4H4N2O4 + GS• C4H4N2O4 + O2 → C4H3N2O4• + O2•− + H+ C4H3N2O4• + O2 → C4H2N2O4 + O2•− + H+ Because it selectively kills the insulin-producing beta-cells found in the pancreas, alloxan is used to induce diabetes in laboratory animals. This occurs most likely because of selective uptake of the compound due to its structural similarity to glucose as well as the beta-cell's highly efficient uptake mechanism (GLUT2). In addition, alloxan has a high affinity to SH-containing cellular compounds and, as a result, reduces glutathione content. Furthermore, alloxan inhibits glucokinase, a SH-containing protein essential for insulin secretion induced by glucose. Most studies have shown that alloxan is not toxic to the human beta-cell, even in very high doses, probably because of differing glucose uptake mechanisms in humans and rodents. Alloxan is, however, toxic to the liver and the kidneys in high doses, as these are tissues where the GLUT2 transporter is expressed in humans. Streptozotocin
ASQ offers 18 professional certifications relating to various aspects of the quality profession. Professional certification exams are translated into five languages included English, Korean, Mandarin, Portuguese, and Spanish. Exams are given nationally and, to a limited degree, worldwide several times annually. The body of knowledge for each certification is maintained through peer review every few years on a rotating schedule. In 1968, the first ASQ certification was offered. In 2016, ASQ's certification exam delivery method changed from paper to computer-based testing at Prometric nationwide testing facilities. ASQ publishes a range of magazines and journals: Quality Progress Journal for Quality and Participation Journal of Quality Technology Quality Engineering Quality Management Journal Lean & Six Sigma Review Software Quality Professional Technometrics Journal for Quality Perspectives in Knowledge Acquisition Quality Management Forum Primers on Human Development and Leadership ASQ hosts a number of quality events and annual conferences worldwide:
Glycogenolysis and gluconeogenesis in liver. Glycogenolysis and lactate release in skeletal muscle. Contract sphincters of Gastrointestinal tract. Thickened secretions from salivary glands. Insulin and glucagon secretion from pancreas. Inhibit histamine-release from mast cells. Increase protein content of secretions from lacrimal glands. Receptor also present in cerebellum. Bronchiole dilation (targeted while treating asthma attacks) Involved in brain - immune - communication Short-acting β2 agonists (SABA) bitolterol fenoterol hexoprenaline isoprenaline (INN) or isoproterenol (USAN) levosalbutamol (INN) or levalbuterol (USAN) orciprenaline (INN) or metaproterenol (USAN) pirbuterol procaterol salbutamol (INN) or albuterol (USAN) terbutaline Long-acting β2 agonists (LABA) arformoterol (some consider it to be an ultra-LABA) bambuterol clenbuterol formoterol salmeterol Ultra-long-acting β2 agonists (ultra-LABA) carmoterol indacaterol milveterol (GSK 159797) olodaterol vilanterol (GSK 642444)
The apical membrane or luminal membrane of a polarized cell is the surface of the plasma membrane that faces inward to the lumen. This is particularly evident in epithelial and endothelial cells, but also describes other polarized cells, such as neurons. The basolateral membrane or basolateral cell membrane of a polarized cell is the surface of the plasma membrane that forms its basal and lateral surfaces. It faces outwards, towards the interstitium, and away from the lumen. Basolateral membrane is a compound phrase referring to the terms "basal (base) membrane" and "lateral (side) membrane", which, especially in epithelial cells, are identical in composition and activity. Proteins (such as ion channels and pumps) are free to move from the basal to the lateral surface of the cell or vice versa in accordance with the fluid mosaic model. Tight junctions join epithelial cells near their apical surface to prevent the migration of proteins from the basolateral membrane to the apical membrane. The basal and lateral surfaces thus remain roughly equivalent to one another, yet distinct from the apical surface.
Generally speaking single-particle measurement instruments desorb particles one at a time using a pulsed laser. The process is called laser desorption/ionization (LDI) and is the primary ionization method used for single-particle measurements. The main advantage of using LDI over thermal desorption, is the ability to analyze both non-refractory and refractory (e.g., mineral dust, soot) components of atmospheric aerosols. Laser vaporization allows precise laser firing when individual particles fly through the vaporization zone, and the systems are thus dubbed single particle mass spectrometers (SPMS). Several versions of SPMS have been reported, including the aerosol time-of-flight mass spectrometer (AToFMS), the laser mass analyzer for particles in the airborne state (LAMPAS), particle analysis by laser mass spectrometer (PALMS), the rapid single-particle mass spectrometer (RSMS), the bioaerosol mass spectrometer (BAMS) b194 Steele et al., 2003), the nanoaerosol mass spectrometer (NAMS), the single-particle laser ablation time-of-flight mass spectrometer (SPLAT), the single-particle aerosol mass spectrometer (SPAMS), and laser ablation aerosol particle time-of-flight mass spectrometer (LAAP-ToF-MS). Among the most commons of these instruments is the aerosol time-of-flight mass spectrometer (AToFMS).
Sources: en.wikipedia.org
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Ectopic fat is the storage of triglycerides in tissues other than adipose tissue, that are supposed to contain only small amounts of fat, such as the liver, skeletal muscle, heart, and pancreas. This can interfere with cellular functions and hence organ function and is associated with insulin resistance in type 2 diabetes. It is stored in relatively high amounts around the organs of the abdominal cavity, but is not to be confused with visceral fat. The specific cause for the accumulation of ectopic fat is unknown. The cause is likely a combination of genetic, environmental, and behavioral factors that are involved in excess energy intake and decreased physical activity. Substantial weight loss can reduce ectopic fat stores in all organs and this is associated with an improvement of the function of those organs. In the latter case, non-invasive weight loss interventions like diet or exercise can decrease ectopic fat (particularly in heart and liver) in overweight or obese children and adults.
An ion-exchange membrane is a semi-permeable membrane that transports certain dissolved ions, while blocking other ions or neutral molecules. Ion-exchange membranes are therefore electrically conductive. They are often used in desalination and chemical recovery applications, moving ions from one solution to another with little passage of water. Important examples of ion-exchange membranes include the proton-exchange membranes, that transport H+ cations, and the anion exchange membranes used in certain alkaline fuel cells to transport OH− anions.
Lectin affinity chromatography is a form of affinity chromatography where lectins are used to separate components within the sample. Lectins, such as concanavalin A are proteins which can bind specific alpha-D-mannose and alpha-D-glucose carbohydrate molecules. Some common carbohydrate molecules that is used in lectin affinity chromatography are Con A-Sepharose and WGA-agarose. Another example of a lectin is wheat germ agglutinin which binds D-N-acetyl-glucosamine. The most common application is to separate glycoproteins from non-glycosylated proteins, or one glycoform from another glycoform. Although there are various ways to perform lectin affinity chromatography, the goal is extract a sugar ligand of the desired protein.
Tens of thousands of three-dimensional protein structures have been determined by X-ray crystallography and protein nuclear magnetic resonance spectroscopy (protein NMR) and a central question in structural bioinformatics is whether it is practical to predict possible protein–protein interactions only based on these 3D shapes, without performing protein–protein interaction experiments. A variety of methods have been developed to tackle the protein–protein docking problem, though it seems that there is still much work to be done in this field. Other interactions encountered in the field include Protein–ligand (including drug) and protein–peptide. Molecular dynamic simulation of movement of atoms about rotatable bonds is the fundamental principle behind computational algorithms, termed docking algorithms, for studying molecular interactions.
Sources: en.wikipedia.org
Sealed vials or containers should be kept at the temperature specified by stability data, often controlled room temperature or 2–8 °C. Moisture and oxygen barriers are important because both can degrade sensitive materials. Opened containers may need immediate use or protection from ambient humidity.
It usually appears as a uniform porous plug or cake that fills the container without excessive shrinkage. Color should match the specification, and there should be no meltback or visible foreign matter. Minor cracking may be acceptable if the product still meets moisture and potency limits.
Water content is a key stability parameter because excess water can promote hydrolysis, aggregation, or cake collapse. It also affects reconstitution and product weight. Each product has a target range, and methods such as Karl Fischer titration are used to verify it.
Karl Fischer titration is a common method, using coulometric or volumetric detection. Thermogravimetric analysis can also measure weight loss on heating. Results depend on sample handling because the dried solid can absorb moisture quickly.